PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn252971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 340aa    MW: 37166.3 Da    PI: 8.1859
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn252971genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.52.1e-3950126278
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 C v+gC++dls+++eyhrrhkvCevhsk+++v++ g+eqrfCqqCsrfh+l efDe+krsCr+rL+ hn+rrrk+q+
  Achn252971  50 CLVDGCNSDLSQCREYHRRHKVCEVHSKTAKVTIGGREQRFCQQCSRFHSLVEFDEGKRSCRKRLDCHNRRRRKPQS 126
                 **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-3245111IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.34247124IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.06E-3748129IPR004333Transcription factor, SBP-box
PfamPF031101.3E-2850123IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGEDGNCGGR ENDKGTGDLM FEDSKFLIME SSGSSKRAKK PSNITHIVSC LVDGCNSDLS  60
QCREYHRRHK VCEVHSKTAK VTIGGREQRF CQQCSRFHSL VEFDEGKRSC RKRLDCHNRR  120
RRKPQSESLS KNTGRFFSSQ QGTTLLSFSG PQLRPSALTN SAWAGAVKAE NDGGVGSYNA  180
HPCLSYVDRP GSFSGSLAQG FGGGNQFKLL QPQDNNHNSA SKNITHVPKL FLDGLDGRVV  240
DSDCALSLLS SVPAETREIG LSHVVQPSPI PYAHSVVHDM HYYDLSHYSQ GIENKPVVSI  300
FSSLVGDNTN NIHCQGMFQN GPDGPSASGS HQTLSFRWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-27501231184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106123KRSCRKRLDCHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270226.11e-109PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010656129.11e-109PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010656134.11e-109PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_010656138.11e-109PREDICTED: squamosa promoter-binding-like protein 16
TrEMBLA5BHV41e-109A5BHV4_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g03910.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-47SBP family protein